PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 336aa    MW: 38393.1 Da    PI: 8.1005
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587330.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.8e-1761106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l ++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
   XP_009587330.1  61 RGHWRPHEDAKLRELVAQFGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 106
                      899*****************************.***********996 PP

2Myb_DNA-binding543.9e-17113156146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l+ a+k++G++ W+ Iar ++ gRt++ +k++w+ 
   XP_009587330.1 113 RRAFSEEEEERLLIAHKMYGNK-WSMIARLFP-GRTDNAVKNHWHV 156
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.44656107IPR017930Myb domain
SMARTSM007174.5E-1460109IPR001005SANT/Myb domain
SuperFamilySSF466896.36E-2861154IPR009057Homeodomain-like
PfamPF002491.7E-1561106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2662114IPR009057Homeodomain-like
CDDcd001673.44E-1264105No hitNo description
PROSITE profilePS5129427.018108162IPR017930Myb domain
SMARTSM007172.0E-13112160IPR001005SANT/Myb domain
PfamPF002491.1E-13113155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-20115161IPR009057Homeodomain-like
CDDcd001673.24E-10115155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MNSTATSCAV QEMNFLLPCV KESPWLFNQM EEERGTNKLK DEKEEVDLVG MRKSNAKLCA  60
RGHWRPHEDA KLRELVAQFG PQNWNLIAEK LEGRSGKSCR LRWFNQLDPR INRRAFSEEE  120
EERLLIAHKM YGNKWSMIAR LFPGRTDNAV KNHWHVIMAR KHREQTSVYR RRKPSNLQQI  180
NFPHIFSASN LNSDSTISSN NNIDDQSAST CTDLSLTPSS SKVIPPFLMS RFTPMQHHHQ  240
EILESNKGIS RHEEVKMESG VHPKFLYGNE EPIAKTVDEG NQCGCGNQSD TNSEISASES  300
VANNTTNVNI YDNGKQEKQM KSKTMHFIDF LGVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31611617107B-MYB
1mse_C6e-31581611104C-Myb DNA-Binding Domain
1msf_C6e-31581611104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00516DAPTransfer from AT5G17800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755222e-75HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587330.10.0PREDICTED: transcription factor LAF1-like
TrEMBLM1CPY71e-144M1CPY7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000722581e-144(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16842470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-70myb domain protein 105